qelt

To 'qelt' is to do the thing only when the left side is right with the body steeped backwards only if the right is to the correct angle while moongooning and sunsounding during the eclipse.

The most difficult and important part of qelting is to move the left part forward increasing mog potential and jelq levels.

'qelt' can also mean an unemployed fuck who sits on discord all day and refuses jobs. Likely plays Overwatch while modding a server.

"I still cant figure out how to qelt yet!!"

"qelt you're so fucking unemployed please for the love of all of us get a job"

by qelt May 10, 2025

qeen

someone who uses their brain like a butt ( Irani's use this word )

I would tell someone who is doing something stupid " Stop being a qeen" or " Yal qeen stop doing that."

by iraniexpert May 10, 2025

qetuoadgjlxvnwryipsfhkzcbm

When the boredom affects you so badly you decide to take the time to type every other letter on the keyboard left to right top to bottom and repeat with an offset.

I was so bored that I used to my time to type out qetuoadgjlxvnwryipsfhkzcbm.

by Deborahlikesleaves. June 12, 2025

Qeysha

Gadis nyentrik tapi cantik, mungkin bisa menyakiti hati tapi juga komedik,

I love qeysha

by Lbenron June 19, 2025

QESH

QESH (n.): When someone you respect slaps you in the face for being a member of a work group saddled with a dumb moniker.

The worst part about QESH isn't the slap itself, but the slow burn of knowing the moniker is really dumb.

by Busted Knuckle September 10, 2025

qeo

154th level of boredom. you typed letters on the keyboard exponentialy , but instead of multiplying by 2 you multiplied by 3. Sad thing , there are only 3 letters in this combination. There are 26 letters in english alphabet and I was 1 letter short to make it 4. I wanted to say "Go touch grass" but you won't do that anyway. Same for me.

"I tried qwerty , mnbvcx , qazwsx , abcdef , zyxwvu , lpmkon , qeypgx , qwrih. They have everything. What if I... qeo? They have even that. I need to try to get more creative with those combinations."

by mbxjsy September 30, 2025

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."

by mbxjsy October 2, 2025