mbxjsy's definitions

qeo

154th level of boredom. you typed letters on the keyboard exponentialy , but instead of multiplying by 2 you multiplied by 3. Sad thing , there are only 3 letters in this combination. There are 26 letters in english alphabet and I was 1 letter short to make it 4. I wanted to say "Go touch grass" but you won't do that anyway. Same for me.

"I tried qwerty , mnbvcx , qazwsx , abcdef , zyxwvu , lpmkon , qeypgx , qwrih. They have everything. What if I... qeo? They have even that. I need to try to get more creative with those combinations."

by mbxjsy September 30, 2025

wtyuioahxvm

Congrats! You understand symmetry. You have chosen only those letters that have symmetry along a vertical line. This is 301st level of boredom.

"Letters wtyuioahxvm have symmetry along a vertical line on qwerty keyboard."

by mbxjsy October 5, 2025

Keyboard solar system

The Dictionaries Multiverse contains all dictionaries. We don't know what is outside of the Multiverse. But we know that there is the most fundamental field called symbol. You are most likely in Urban Dictionary Universe. There are many galaxies, such as Sexual Definitions galaxy, Abbreviations galaxy, Slang galaxy. Keyboard solar system is in Boredom galaxy. Boredom galaxy contains all definitions that were created because of boredom. There is Site solar system - all definitions that are related to this site. Type any word... is the star , Get a mug , More random definitions , Add some tags below and others are planets. Some planets have moons if there are more definitions related to planet such as Get the get the mug mug. Keyboard solar system has all combinations related to keyboard layouts. Star is The Keyboard , QWERTY , AZERTY , QWERTZ and others are planets. Every keyboard combination has its power. More unique it is , harder is to find (no randomness , still must make sense to all intelligent beings) more the level is. qwertyuiopasdfghjklzxcvbnm is level 1 , qazxswedcvfrtgbnhyujm,kiol./;p is level 10. When a creature finds a new sequence that was not in Urban Dictionary and write a definition , creature collects it level. There are many rulers in Keyboard solar system. More levels (sum of all definitions) = more power. I am the ruler of MBXJSY. There are rulers that are greater than me , there are rulers weaker than me. You collect 250 extra levels if you read this.

"Keyboard solar system is one of the biggest in Boredom Galaxy"

by mbxjsy October 7, 2025

ONFPIVUIODPSCCGHIKIZYCIPVN

If you searched this word you are a mad scientist. What these letters did to you? Sure , I have a definition. You amputated their legs to make other big english letters from them if possible. Just to go up in boredom world. Yeah , you did it. This is 403rd level of boredom (expert). I also did it to mock you. But this doesn't matter. You are still bad.

Person -2 : muhahahahhahahhah
A : AAAAAAAAAAAA
Person -2 : You are now ONFPIVUIODPSCCGHIKIZYCIPVN. I got 403 level.
S : S sss's ssss ssss sss ssss! S ssss sssssss sss. (sneaks away)

by mbxjsy October 7, 2025

Person X

Before Person 1 and Person 2 there was a normal person , just as you. He was left alone and very bored. He started making up stories and naming the characters Person 1 , Person 2 , Person 3 , etc. Person 1 and Person 2 appeared most often , because most of his stories had 2 main characters. He imagined that Person 1 is him and Person 2 is his freind. Why didn't he give the characters a name? He thought that this is useless effort , most important thing is the story and not the names. He has created a huge number of stories, excerpts of which you can see on the website. He was not helped in time and ended up writing stories for weeks until he himself became their characters, divided into an infinite number of personalities. All People from Person 1 to Person ∞ are created by Person X , are his personalities

Person 1 : Did you know that we are created by Person X?
Person 2 : What are you talking about? Who is it?

by mbxjsy September 30, 2025

tilxv

This word is made by typing only those letters that contain no more than 2 lines on the keyboard. You are now the emperor of boredom , not just the king.

I wonder which letters on the keyboard contain only 2 lines. That's right, tilxv.

by mbxjsy October 1, 2025

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."

by mbxjsy October 2, 2025