Definitions by mbxjsy
q2uertyuiopasdfghjklzxcvbnm
1st secret level of boredom. qwerty sequence but you're replacing the letter w with an equal product of 2 and u. You're left with 25 unknowns instead of 26.
"Qwertyuiopasdfghjklzxcvbnm is equal to q2uertyuiopasdfghjklzxcvbnm"
q2uertyuiopasdfghjklzxcvbnm by mbxjsy October 3, 2025
qwyb
So you want to try all math actions? And now it is factorial's turn. You got this word by choosing 1st (1!) , 2nd (2!) , 6th (3!) and 24th (4!) letter of qwerty sequence. This is 298th level of boredom. Instead of saying stop I will say continue. Either you will stop because you can't think of a new original sequence (qwerty but qwert in the end instead of start and simular don't count) or you will develop your brain with that.
qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."
qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm by mbxjsy October 2, 2025
wetyiafhklzxvnm
the classic qwerty sequence , fifth level of boredom , good old times , but without letters with curved lines on classic keyboard. This is 142th stage of boredom , but maybe It is not so boring after all?
Person 0 : I am bored
Person 1 : You tried typing qwertyuiopasdfghjklzxcvbnm?
Person 0 : No. I hate curved lines , there are too many.
Person 1 : Then try typing wetyiafhklzxvnm.
Person 0 : Great idea!
Person 1 : You tried typing qwertyuiopasdfghjklzxcvbnm?
Person 0 : No. I hate curved lines , there are too many.
Person 1 : Then try typing wetyiafhklzxvnm.
Person 0 : Great idea!
wetyiafhklzxvnm by mbxjsy September 30, 2025