Skip to main content

Definitions by mbxjsy

q2uertyuiopasdfghjklzxcvbnm 

1st secret level of boredom. qwerty sequence but you're replacing the letter w with an equal product of 2 and u. You're left with 25 unknowns instead of 26.
"Qwertyuiopasdfghjklzxcvbnm is equal to q2uertyuiopasdfghjklzxcvbnm"
So you want to try all math actions? And now it is factorial's turn. You got this word by choosing 1st (1!) , 2nd (2!) , 6th (3!) and 24th (4!) letter of qwerty sequence. This is 298th level of boredom. Instead of saying stop I will say continue. Either you will stop because you can't think of a new original sequence (qwerty but qwert in the end instead of start and simular don't count) or you will develop your brain with that.
"qwyb is one of sequences that were made by using math actions"
qwyb by mbxjsy October 2, 2025

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm 

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."
This word is made by typing only those letters that contain no more than 2 lines on the keyboard. You are now the emperor of boredom , not just the king.
I wonder which letters on the keyboard contain only 2 lines. That's right, tilxv.
tilxv by mbxjsy October 1, 2025
This is my new word
Someone who create combinations of characters on a keyboard in a specific sequence(someone who qaz)
Person 19 : I am so bored. I qazed all day.
Person 2 : You are such a qazer. You do this every day!
qazer by mbxjsy September 30, 2025
qaz - qazed - qazed
this is my new word. A verb that describes the act of creating combinations of characters on a keyboard in a specific sequence.
Person 19 : I am so bored , I qazed all day
qaz by mbxjsy September 30, 2025

wetyiafhklzxvnm 

the classic qwerty sequence , fifth level of boredom , good old times , but without letters with curved lines on classic keyboard. This is 142th stage of boredom , but maybe It is not so boring after all?
Person 0 : I am bored
Person 1 : You tried typing qwertyuiopasdfghjklzxcvbnm?
Person 0 : No. I hate curved lines , there are too many.

Person 1 : Then try typing wetyiafhklzxvnm.
Person 0 : Great idea!
wetyiafhklzxvnm by mbxjsy September 30, 2025