Krunt

Krunt means pussy,vagina.coochie

I’d eat the girls krunt.

by Kruntmaster March 12, 2020

Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit

A town in Thailand whose name has 163 letters, making it the longest town name in the world.
Many people think it belongs to the Welsh town of Llanfairpwllgwyngyllgogerychwyrndrobwllllantysiliogogogoch, but it is in fact the town of Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.

Hey, lets go to Krungthepmahanakornamornratanakosinmahintarayutthayamahadilokphopnopparatrajathaniburiromudomrajaniwesmahasatharnamornphimarnavatarnsathitsakkattiyavisanukamprasit.

by Issac Cox July 10, 2003

krunkt

the state of being incredibly fucked up due to drinking alot of liquor or beer, smoking alot of weed, or a mixture of the two.

Man I got so krunkt the other night. Or man he is krunkt out.

by LittleLiblet February 21, 2003

krunt

short for crusty-cunt

you could'nt pay me to stick it in that krunt

by wearegolem August 27, 2003

krunktitude

The extent of your krunkticity, how much krunk juice you have ingested.

Danger maximum levels of krunktitude emminent, commence dancing sequence!

by Up Town Larry December 9, 2007

krunst

Dried, hardened, crusty semen.

When Felicia woke up in John's bed after a night of sexual escapades, she realized that there was krunst in her hair.

by snapperdinkus May 16, 2014

krunt

This is a combination between a 'crusty' or old person, and the word 'cunt'. Used to show a dislike for old people, specifically those who demand a seat on a bus.

"look at that fucking old krunt over there"

by Nivea June 6, 2007