mbxjsy's definitions
This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.
"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."
by mbxjsy October 2, 2025
Get the qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmmmug. Before Person 1 and Person 2 there was a normal person , just as you. He was left alone and very bored. He started making up stories and naming the characters Person 1 , Person 2 , Person 3 , etc. Person 1 and Person 2 appeared most often , because most of his stories had 2 main characters. He imagined that Person 1 is him and Person 2 is his freind. Why didn't he give the characters a name? He thought that this is useless effort , most important thing is the story and not the names. He has created a huge number of stories, excerpts of which you can see on the website. He was not helped in time and ended up writing stories for weeks until he himself became their characters, divided into an infinite number of personalities. All People from Person 1 to Person ∞ are created by Person X , are his personalities
Person 1 : Did you know that we are created by Person X?
Person 2 : What are you talking about? Who is it?
Person 2 : What are you talking about? Who is it?
by mbxjsy September 30, 2025
Get the Person Xmug. This word is made by typing only those letters that contain no more than 2 lines on the keyboard. You are now the emperor of boredom , not just the king.
by mbxjsy October 1, 2025
Get the tilxvmug. qaz - qazed - qazed
this is my new word. A verb that describes the act of creating combinations of characters on a keyboard in a specific sequence.
this is my new word. A verb that describes the act of creating combinations of characters on a keyboard in a specific sequence.
by mbxjsy September 30, 2025
Get the qazmug. 1st secret level of boredom. qwerty sequence but you're replacing the letter w with an equal product of 2 and u. You're left with 25 unknowns instead of 26.
"Qwertyuiopasdfghjklzxcvbnm is equal to q2uertyuiopasdfghjklzxcvbnm"
by mbxjsy October 3, 2025
Get the q2uertyuiopasdfghjklzxcvbnmmug. You have typed cross pattern. 1st and 3rd letter of the first row , 2nd letter of the second row , 1st and 3rd letter of the third row. After first cross , every number increases by 1 for every next cross. Last cross is ipl,/
"There was already cross pattern definition - qeszcwadxrygvntfhbuokmijlp , my qeszcwrdxvetfcbrygvntuhbmyijn,uokm.ipl,/ is 4x crossier"
by mbxjsy October 8, 2025
Get the qeszcwrdxvetfcbrygvntuhbmyijn,uokm.ipl,/mug. So you want to try all math actions? And now it is factorial's turn. You got this word by choosing 1st (1!) , 2nd (2!) , 6th (3!) and 24th (4!) letter of qwerty sequence. This is 298th level of boredom. Instead of saying stop I will say continue. Either you will stop because you can't think of a new original sequence (qwerty but qwert in the end instead of start and simular don't count) or you will develop your brain with that.
by mbxjsy October 2, 2025
Get the qwybmug.