mbxjsy's definitions

tilxv

This word is made by typing only those letters that contain no more than 2 lines on the keyboard. You are now the emperor of boredom , not just the king.

I wonder which letters on the keyboard contain only 2 lines. That's right, tilxv.

by mbxjsy October 1, 2025

qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm

This word starts as a qeypgx sequence , where you start with q , then skip 1 letter and then skip one more letter for every next letter (2,3,4,5). But instead of stopping when letters ended you continue from the start every time. 349th level of boredom (advanced). You are either a math genius that still won't do his howemork or you found this by typing qeypgx and scrolling down or in the search bar. This sequence repeats after that. This happens because at first a number that adds up (q is 1st , e is 3rd , y is 6th) is 2,3,4,5,6.... or a(alphabet , 26 letters)-24 , a-23 , a-22 , a-21 , a-20 , etc.
Up to a-4 , a-3 , a-2 , a-1 , a. And after it is a+1 , a+2 , a+3 , a+4 , a+5.... After a+25 and 2a it is 3a-25 , 3a-24 ...... 3a-1 , 3a , 3a+1 , 3a+2... you can just not count these 2a , because they are 2 full alphabets , sequence is the same without them. Every half of a cycle (from a to 2a or from 2a to 3a) there is a special place with 2 same letters in a row - d(13th letter) or m (26th letters). Half of a cycle is 26 letters , full cycle is 52 letters. You can found n-th letter in the sequence by using this formula - n(n+1):2 and extracting full alphabets (26) until you get a number from 1 to 26 because 1*(1+1):2 , 2*(2+1):2 , 3*(3+1):2 .... is the same sequence. 26(26+1):2 is equal to 26 squared + 26:2 , we can just not count 26 squared because these are full alphabets. 26:2 is 13th letter D.

"Same for 52 , 52 squared is 104 full alphabets , 52:2 is 26th letter M. 78:2 is 39 , 39-26 is 13th letter D 104:2 is 52 , 52-26 is 26th letter M. Number increases by 13 every time because it is half of 26. That's why full cycle is 52 and that's why there are d and m repeating in qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm"
"I wonder what happens if I continue the qeypgx sequence. Brilliant! qeypgxwplefmdqhyvgiwvlhfddfhlvwigvyhqdmfelpwxgpyeqmm."

by mbxjsy October 2, 2025

qwyb

So you want to try all math actions? And now it is factorial's turn. You got this word by choosing 1st (1!) , 2nd (2!) , 6th (3!) and 24th (4!) letter of qwerty sequence. This is 298th level of boredom. Instead of saying stop I will say continue. Either you will stop because you can't think of a new original sequence (qwerty but qwert in the end instead of start and simular don't count) or you will develop your brain with that.

"qwyb is one of sequences that were made by using math actions"

by mbxjsy October 2, 2025

q2uertyuiopasdfghjklzxcvbnm

1st secret level of boredom. qwerty sequence but you're replacing the letter w with an equal product of 2 and u. You're left with 25 unknowns instead of 26.

"Qwertyuiopasdfghjklzxcvbnm is equal to q2uertyuiopasdfghjklzxcvbnm"

by mbxjsy October 3, 2025

qwetyuioasdhkzxcvnm

Congrats! You have chosen only symmetrical letters(by any 1 line , on the keyboard)! This is 277 level of boredom.

"I wonder which letters in qwertyuiopasdfghjklzxcvbnm are symmetrical. That's right , qwetyuioasdhkzxcvnm."

by mbxjsy October 3, 2025

wtyuioahxvm

Congrats! You understand symmetry. You have chosen only those letters that have symmetry along a vertical line. This is 301st level of boredom.

"Letters wtyuioahxvm have symmetry along a vertical line on qwerty keyboard."

by mbxjsy October 5, 2025

ioshzxn

You are great in symmetry! You have chosen only those letters that have mirror symmetry. If you don't know what it is, 1 half of the letter rotates 180 degrees around the center. 2 identical halves , but 1 is rotated. 350th level of boredom (advanced+)

"Letters ioshzxn have mirror symmetry in qwerty sequence"

by mbxjsy October 5, 2025